CDS

Accession Number TCMCG058C29182
gbkey CDS
Protein Id KAF7151019.1
Location complement(join(12079349..12079539,12079870..12079933,12080395..12080490))
Organism Rhododendron simsii
locus_tag RHSIM_Rhsim02G0076400

Protein

Length 116aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA588298, BioSample:SAMN13241185
db_source WJXA01000002.1
Definition hypothetical protein RHSIM_Rhsim02G0076400 [Rhododendron simsii]
Locus_tag RHSIM_Rhsim02G0076400

EGGNOG-MAPPER Annotation

COG_category L
Description Bifunctional DNA N-glycosylase with associated apurinic apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N- glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko03400        [VIEW IN KEGG]
KEGG_ko ko:K10773        [VIEW IN KEGG]
EC 4.2.99.18        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko03410        [VIEW IN KEGG]
map03410        [VIEW IN KEGG]
GOs GO:0000702        [VIEW IN EMBL-EBI]
GO:0000703        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0003906        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005911        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006259        [VIEW IN EMBL-EBI]
GO:0006281        [VIEW IN EMBL-EBI]
GO:0006284        [VIEW IN EMBL-EBI]
GO:0006285        [VIEW IN EMBL-EBI]
GO:0006289        [VIEW IN EMBL-EBI]
GO:0006296        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006479        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006974        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008168        [VIEW IN EMBL-EBI]
GO:0008170        [VIEW IN EMBL-EBI]
GO:0008213        [VIEW IN EMBL-EBI]
GO:0008276        [VIEW IN EMBL-EBI]
GO:0008757        [VIEW IN EMBL-EBI]
GO:0009295        [VIEW IN EMBL-EBI]
GO:0009506        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016278        [VIEW IN EMBL-EBI]
GO:0016279        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016741        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016798        [VIEW IN EMBL-EBI]
GO:0016799        [VIEW IN EMBL-EBI]
GO:0018022        [VIEW IN EMBL-EBI]
GO:0018193        [VIEW IN EMBL-EBI]
GO:0018205        [VIEW IN EMBL-EBI]
GO:0019104        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0030054        [VIEW IN EMBL-EBI]
GO:0032259        [VIEW IN EMBL-EBI]
GO:0033554        [VIEW IN EMBL-EBI]
GO:0033683        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042644        [VIEW IN EMBL-EBI]
GO:0042646        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0043414        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051716        [VIEW IN EMBL-EBI]
GO:0055044        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0090305        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:0140097        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTTGTGGGACAATGTTCAGGGGATCTGTGTAGATGCTCATGTGCATCGTATCTGCAATAGACTTGGGTGGGTCTCACGGCCAGGCACAAAACAGGATCATGTTGTTCCATTAAAAGCATCCTTTTCCTCGAACTGGTTAAAAGCAGTTGATGATGATACAATACTAATTTGTGTTCCTCTGTTTTCTTGTCAGAATACTACGACTCCAGAGCAAACGAGAGAGTCGTTGCAACTCTGGCTTCCAAAGGAACAGTGGGTTCCAATTAACCCTCTTTTAGTATGTTTGAGCTCAGTCTTCCCACATGAATATGCGTCCGCACACATCCATTTGCTATGGTTTGTAGGATAA
Protein:  
MLWDNVQGICVDAHVHRICNRLGWVSRPGTKQDHVVPLKASFSSNWLKAVDDDTILICVPLFSCQNTTTPEQTRESLQLWLPKEQWVPINPLLVCLSSVFPHEYASAHIHLLWFVG